Account

GHRF Analog · Research Peptide

Tesamorelin

Name: Tesamorelin
Brand: Peptides Optimized
SKU: tesamorelin
Availability: InStock

TH9507Tesamorelin acetate

Tesamorelin is a synthetic 44-amino-acid analog of human growth hormone-releasing factor bearing a trans-3-hexenoyl group on its N-terminal tyrosine residue. It is supplied lyophilized for laboratory research, third-party tested to 99%+ HPLC purity, for research use only — not for human or veterinary use.

Supplied lyophilized — requires BAC water

99%+ HPLC purityThird-party testedEndotoxin testedShips from USA

Size

View Certificate of Analysis

Qty1

From$48$68.57Save 30%

Order before 2:00 PM CDT to ship todayCutoff 2:00 PM CDT

Free shipping on every order · ships from the USA, tracked60-Day Money-Back GuaranteeFull refund if you’re not satisfied

We accept

Secure checkout

Secure checkout · 256-bit SSL

Lab Verified

Certificate of Analysis

Review the published certificate for each listed strength, including its batch number and reported purity, potency, identity, heavy metals, sterility and endotoxin results.

7verified batches

LatestPass7× Tested

99.14%

Purity

Passed full QC panel

Variant: Tesamorelin 5 mg
Batch #: TSM5-J14
Labeled: 5 mg
Actual: 5.08 mg
Tested: Aug 11, 2026

Full QC Panel7× tested

Purity · HPLC · USP <621>99.14%

Net Peptide · USP <621>5.08 mg

Identity · LC-MSTesamorelin

FTIR · USP <197A>Conforms

Heavy Metals · ICP-MS <233>Not Detected

Sterility · USP <71>No Growth

Endotoxin · USP <85>0.09 EU/vial

View full COA

Genesis Biolabs · COA #3080686 · verify

Pass7× Tested

99.35%

Purity

Passed full QC panel

Variant: Tesamorelin 5 mg
Batch #: TSM5-J13
Labeled: 5 mg
Actual: 5.18 mg
Tested: Aug 25, 2026

Full QC Panel7× tested

Purity · HPLC · USP <621>99.35%

Net Peptide · USP <621>5.18 mg

Identity · LC-MSTesamorelin

FTIR · USP <197A>Conforms

Heavy Metals · ICP-MS <233>Not Detected

Sterility · USP <71>No Growth

Endotoxin · USP <85>0.08 EU/vial

View full COA

Genesis Biolabs · COA #5762544 · verify

Pass7× Tested

99.22%

Purity

Passed full QC panel

Variant: Tesamorelin 5 mg
Batch #: TSM5-260705
Labeled: 5 mg
Actual: 5.02 mg
Tested: Jul 5, 2026

Full QC Panel7× tested

Purity · HPLC · USP <621>99.22%

Net Peptide · USP <621>5.02 mg

Identity · LC-MSTesamorelin

FTIR · USP <197A>Conforms

Heavy Metals · ICP-MS <233>Not Detected

Sterility · USP <71>No Growth

Endotoxin · USP <85>0.05 EU/vial

View full COA

Genesis Biolabs · COA #1578639 · verify

Pass7× Tested

99.23%

Purity

Passed full QC panel

Variant: Tesamorelin 5 mg
Batch #: TSM5-260608
Labeled: 5 mg
Actual: 5.09 mg
Tested: Jun 8, 2026

Full QC Panel7× tested

Purity · HPLC · USP <621>99.23%

Net Peptide · USP <621>5.09 mg

Identity · LC-MSTesamorelin

FTIR · USP <197A>Conforms

Heavy Metals · ICP-MS <233>Not Detected

Sterility · USP <71>No Growth

Endotoxin · USP <85>0.08 EU/vial

View full COA

Genesis Biolabs · COA #1517492 · verify

Pass7× Tested

99.54%

Purity

Passed full QC panel

Variant: Tesamorelin 5 mg
Batch #: TSM5-260510
Labeled: 5 mg
Actual: 4.98 mg
Tested: May 10, 2026

Full QC Panel7× tested

Purity · HPLC · USP <621>99.54%

Net Peptide · USP <621>4.98 mg

Identity · LC-MSTesamorelin

FTIR · USP <197A>Conforms

Heavy Metals · ICP-MS <233>Not Detected

Sterility · USP <71>No Growth

Endotoxin · USP <85>0.08 EU/vial

View full COA

Genesis Biolabs · COA #1553380 · verify

Pass7× Tested

99.42%

Purity

Passed full QC panel

Variant: Tesamorelin 5 mg
Batch #: TSM5-260511
Labeled: 5 mg
Actual: 4.98 mg
Tested: May 11, 2026

Full QC Panel7× tested

Purity · HPLC · USP <621>99.42%

Net Peptide · USP <621>4.98 mg

Identity · LC-MSTesamorelin

FTIR · USP <197A>Conforms

Heavy Metals · ICP-MS <233>Not Detected

Sterility · USP <71>No Growth

Endotoxin · USP <85>0.12 EU/vial

View full COA

Genesis Biolabs · COA #1539422 · verify

Pass7× Tested

99.56%

Purity

Passed full QC panel

Variant: Tesamorelin 5 mg
Batch #: TSM5-260402
Labeled: 5 mg
Actual: 5.1 mg
Tested: Apr 2, 2026

Full QC Panel7× tested

Purity · HPLC · USP <621>99.56%

Net Peptide · USP <621>5.1 mg

Identity · LC-MSTesamorelin

FTIR · USP <197A>Conforms

Heavy Metals · ICP-MS <233>Not Detected

Sterility · USP <71>No Growth

Endotoxin · USP <85>0.09 EU/vial

View full COA

Genesis Biolabs · COA #1570376 · verify

Frequently Researched Together

Research compounds our customers frequently order alongside this one.

AOD-9604 research peptide vial - Peptides Optimized

AOD-9604hGH Fragment

From $60

CJC-1295 / Ipamorelin research peptide vial - Peptides Optimized

CJC-1295 / IpamorelinGHRH Analog / GH Secretagogue Blend

From $54.99

CJC-1295 No DAC research peptide vial - Peptides Optimized

CJC-1295 No DACGHRH Analog

From $29.99

IGF-1 LR3 research peptide vial - Peptides Optimized

IGF-1 LR3Recombinant Protein Analog

From $75

Sermorelin research peptide vial - Peptides Optimized

SermorelinGHRH Analog

From $42.99

Ipamorelin research peptide vial - Peptides Optimized

IpamorelinGH Secretagogue Pentapeptide

From $24.99

Tesamorelin Ipamorelin research peptide vial - Peptides Optimized

Tesamorelin IpamorelinGHRH Analog / GH Secretagogue Blend

From $54.99

GHRP-2 research peptide vial - Peptides Optimized

GHRP-2GH Secretagogue Hexapeptide

From $24

Compound Information

Technical specifications

Molecular Profile

What is Tesamorelin?

Type: Synthetic peptide
CAS Number: 218949-48-5
Molecular Weight: 5135.86 g/mol
Amino Acids: 44
Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula

Important Research Notice

This product is for research and laboratory use only. It is not approved for human or veterinary therapeutic use.
Storage, handling, and disposal must comply with applicable local, state, and federal regulations.
Researchers are responsible for verifying intended use and ensuring compliance with their institutional protocols.

Elevate Your
Research Protocol

Research-grade peptides with published lab documentation, fast shipping, and dedicated research support.

Browse products Wolverine research peptide 20mg vial - Peptides Optimized

Retatrutide (GLP-3) research peptide 5mg vial - Peptides Optimized

Tesamorelin research peptide 5mg vial - Peptides Optimized

Subscribe to our Newsletter

Subscribe to our newsletter to get daily insights, news, updates.

Tesamorelin

Certificate of Analysis

Frequently Researched Together

Compound Information

What is Tesamorelin?

Important Research Notice

Elevate YourResearch Protocol

Subscribe to our Newsletter

Stability Information

Elevate Your
Research Protocol